PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_302_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 1076aa    MW: 118793 Da    PI: 7.5934
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_302_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.84.2e-40154230177
                                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                                         +Cqv++C++dls+ak+yhrrhkvCe hska+++lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk
  cra_locus_302_iso_1_len_3982_ver_3 154 MCQVDNCREDLSHAKDYHRRHKVCELHSKATKALVAKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRK 228
                                         6*************************************************************************9 PP

                                         -- CS
                                 SBP  76 kq 77 
                                         + 
  cra_locus_302_iso_1_len_3982_ver_3 229 TL 230
                                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-33149216IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.778152229IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.81E-37153232IPR004333Transcription factor, SBP-box
PfamPF031104.1E-29155228IPR004333Transcription factor, SBP-box
CDDcd002046.47E-4872975No hitNo description
SuperFamilySSF484035.51E-5874977IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1076 aa     Download sequence    Send to blast
MEDVSAQIAS PIFIHQHQPF ASRFHEAHVV AKKRSLPFTN NQPPKPFDSW NPKQWEWDST  60
RFIAKPIESD VLRLGTAAEL EAARARKEES NNAANFNKSI HVDEESEDLR LKLGAGGVGA  120
SGGGRIPLNS VEEPVSRPNK RVRSGSPGSA SYPMCQVDNC REDLSHAKDY HRRHKVCELH  180
SKATKALVAK QMQRFCQQCS RFHPLSEFDE GKRSCRRRLA GHNRRRRKTL PEDTTASRLL  240
VPGNRENNGN ADLDIVNFLA ILARAQGNTE DKGANFLSVP DKDQLLQILT KINSLPLPAN  300
LAAKLPVLGS LNRSMSNQVP SENHSPLDVN TRPSTMDLLA VLSTTPASTT QNSLEIQTER  360
SSQGGDSEKT NSSCSIQATC LNLQNMPAFG LPSIGGERSS SSQQSPIEDS DGHVEEMHAN  420
IPLQLFSSSP EDNCRPKLPA SRKYFSSGSS NPSVDPSPSS SPPVVQKLFP IYSARETLES  480
GSRANSGEDV VNSRAIQHSG CNTSLQLFGN STMGTGVGLI QNFPYQTGYT SSSGSDHSPS  540
SLNSDPQDRT GRIIFKLFDK DPSHLPGSLR SQIYNWLLKS PSEMESYIRP GCVVLSVYLS  600
MPSSSWEQFE ANLLQYVKSL TKDFNTEFWS NGRFLVCTGK QLALRVDGKL RLFKPRKAWT  660
SPELISVSPL AVVGGQETSV LLRGRNLITS EAKINCSHTA DYTVKEVSGL ACEESEYDEI  720
NLCNFKVCTS SSSILGRCFI EVENGLRGTS FPVIIADKAI CQELRVLEHD ISDESKTEED  780
VLADHLQDSG RPRSRAEILH FLNELGWLFQ RKCNSTLLQG PDYRISRFKF LLIFSVEHDF  840
CALVKGLLDI LVEINLGREG LEIESLEMLS QIHLLNRAVK RRCKKMIDLL INYSIADSSN  900
LTKRYIFPPN LVGPGGITPL HLAACSSGLD DIVDSLTSDA QEIGLHCWNS LLDANGLSPH  960
AYAEMRNNHS YNRLVAQKLA DKRNGQVSVS IGNEIEPLWL NVNPQTRAAT HFKPDQGSCS  1020
KCAAASMRYN WRNPVSQGLL HRPYIHSMLA IAAVCVCVCL FLRGAPDIGS VAPFAW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-32145228184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1876881RAVKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273784.10.0PREDICTED: squamosa promoter-binding-like protein 14 isoform X2
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A068UG600.0A0A068UG60_COFCA; Uncharacterized protein
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128871219